X
Email:
sales@ruixibiotech.com

Beta Amyloid [1-42] Peptide (Rat),Cas:166090-74-0

Beta Amyloid [1-42] Peptide (Rat)

Catalog # Pkg Size Price(USD) Quantity Buy this product
R-M-1451 1mg 426.00
- +
+ Add to cart

Product description

Beta Amyloid [1-42] Peptide (Rat) is a rat form of the predominant amyloid β-peptide found in plaques associated with Alzheimer disease. Leads to a large shift in the bax/bcl-2 ratio in favour of pro-apoptotic bax. 


Appearance N/A
Molecular weight N/A
Purity >90%
Solubility N/A
Cas 166090-74-0
Sequence Rat: H-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH or H-DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH
Molecular Formula C199H307N53O59S1
Storage -20℃,protected from light and moisture
Transportation 4-25℃ temperature for up to 2 weeks
Stability 1 year
Document

Related Product