Beta Amyloid [1-42] Peptide (Rat),Cas:166090-74-0
Beta Amyloid [1-42] Peptide (Rat)
Product description
Beta Amyloid [1-42] Peptide (Rat) is a rat form of the predominant amyloid β-peptide found in plaques associated with Alzheimer disease. Leads to a large shift in the bax/bcl-2 ratio in favour of pro-apoptotic bax.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 166090-74-0 |
Sequence | Rat: H-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH or H-DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH |
Molecular Formula | C199H307N53O59S1 |
Storage | -20℃,protected from light and moisture |
Transportation | 4-25℃ temperature for up to 2 weeks |
Stability | 1 year |
Document
Related Product